PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10019103m
Common NameCARUB_v10019103mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 310aa    MW: 35505.9 Da    PI: 9.0148
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10019103mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-1564109147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W   Ed +l ++v+ +G+ +W+ Ia+ m+ gRt+k+c++rw++ 
  Carubv10019103m  64 RGHWRISEDTQLMELVAVYGPQNWNHIAENMQ-GRTGKSCRLRWFNQ 109
                      789999**************************.***********996 PP

2Myb_DNA-binding46.86.6e-15119160447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +  eE+e+l+ a++ +G++ W+ Ia+ ++ gRt++ +k++w+ +
  Carubv10019103m 119 FAVEEEERLLAAHRAFGNK-WAMIAKLFN-GRTDNALKNHWHVL 160
                      567****************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.77859110IPR017930Myb domain
SMARTSM007172.8E-1163112IPR001005SANT/Myb domain
PfamPF002495.3E-1564109IPR001005SANT/Myb domain
SuperFamilySSF466897.11E-2764157IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-2365117IPR009057Homeodomain-like
CDDcd001671.64E-1067108No hitNo description
PROSITE profilePS5129424.327111165IPR017930Myb domain
SMARTSM007177.8E-12115163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-19118165IPR009057Homeodomain-like
PfamPF002493.0E-11118160IPR001005SANT/Myb domain
CDDcd001671.65E-8122161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MDFSCFQEYP FGLQCRGTFN GFGENNAVSE TVEEFCNKGR MQKKKSDDDL KKKKKQSCSR  60
VCSRGHWRIS EDTQLMELVA VYGPQNWNHI AENMQGRTGK SCRLRWFNQL DPRINKRAFA  120
VEEEERLLAA HRAFGNKWAM IAKLFNGRTD NALKNHWHVL MARKMRQQSS SYVQRFNGSN  180
HNKPNTDHKI FNLSPGNEDD EDMNLRKYSW EMLKEGTTNL KAQYLQEEYC SSRMPRQGPH  240
QHYSTFPADS LALTLHVSIQ EPSSSSSSSS LSLPSSSTAE HTMVTRYIET TKPPAFIDFL  300
GVGHLSSNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-30641654105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2727320.0AF272732.1 Arabidopsis thaliana putative transcription factor (MYB110) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292843.10.0hypothetical protein CARUB_v10019103mg
TrEMBLR0FTE60.0R0FTE6_9BRAS; Uncharacterized protein
STRINGAT3G29020.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63001846
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.21e-169myb domain protein 110